Lineage for d4ppca1 (4ppc A:357-619)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983087Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983088Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 2983141Domain d4ppca1: 4ppc A:357-619 [267202]
    Other proteins in same PDB: d4ppca2, d4ppcb2
    automated match to d4l7sa_
    complexed with 2vw

Details for d4ppca1

PDB Entry: 4ppc (more details), 2.95 Å

PDB Description: itk kinase domain with compound 27 (n-{1-[(1r)-3-(dimethylamino)-1- phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3- carboxamide)
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4ppca1:

Sequence, based on SEQRES records: (download)

>d4ppca1 d.144.1.7 (A:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records): (download)

>d4ppca1 d.144.1.7 (A:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgglvhlgywlnkdkvaiktiieeaevmmklshpklvqlygvcleq
apiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvihrdlaarnc
lvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipyenrsnsev
vedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaesg

SCOPe Domain Coordinates for d4ppca1:

Click to download the PDB-style file with coordinates for d4ppca1.
(The format of our PDB-style files is described here.)

Timeline for d4ppca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ppca2