Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries) Uniprot Q08881 357-619 |
Domain d4ppbb1: 4ppb B:357-619 [267201] Other proteins in same PDB: d4ppba2, d4ppbb2 automated match to d4l7sa_ complexed with 2vv |
PDB Entry: 4ppb (more details), 2.82 Å
SCOPe Domain Sequences for d4ppbb1:
Sequence, based on SEQRES records: (download)
>d4ppbb1 d.144.1.7 (B:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk erpedrpafsrllrqlaeiaesg
>d4ppbb1 d.144.1.7 (B:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiedfieeaevmmklshpklvqlyg vcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvihrdl aarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipyen rsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaesg
Timeline for d4ppbb1: