SCOPe 2.08: Domain d4ppba1: 4ppb A:357-619

Lineage for d4ppba1 (4ppb A:357-619)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
   Uniprot Q08881 357-619

8. Domain d4ppba1: 4ppb A:357-619 [267200]
   Other proteins in same PDB: d4ppba2, d4ppbb2
   automated match to d4l7sa_
   complexed with 2vv

Details for d4ppba1

PDB Entry: 4ppb, 2.82 Å

PDB Description: itk kinase domain with compound 28 (n-{1-[(1s)-3-(dimethylamino)-1- phenylpropyl]-1h-pyrazol-4-yl}-6-(1h-pyrazol-4-yl)-1h-indazole-3- carboxamide)

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4ppba1:

Sequence, based on SEQRES records:

>d4ppba1 d.144.1.7 (A:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records):

>d4ppba1 d.144.1.7 (A:357-619) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiedfieeaevmmklshpklvqlyg
vcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvihrdl
aarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipyen
rsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaesg

Timeline for d4ppba1:

• d4ppba1 first appeared in SCOPe 2.05, called d4ppba_
  
• d4ppba1 appears in SCOPe 2.07