SCOPe 2.05: Domain d4pold_: 4pol D:

Lineage for d4pold_ (4pol D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)

8. Domain d4pold_: 4pol D: [267191]
   automated match to d2xbia_
   complexed with com

Details for d4pold_

PDB Entry: 4pol, 2.8 Å

PDB Description: crystal structures of thioredoxin with mesna at 2.8a resolution

PDB Compounds: (D:) thioredoxin

SCOPe Domain Sequences for d4pold_:

Sequence; same for both SEQRES and ATOM records:

>d4pold_ c.47.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tmvkqiesktafqkalkaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdv
ddcqdvasecevkcmptfqffkkgqkvgefsgankkkleatinklv

Timeline for d4pold_:

• d4pold_ is new in SCOPe 2.05-stable
  
• d4pold_ is called d4pold1 in SCOPe 2.06
  
• d4pold_ appears in the current release, SCOPe 2.08, called d4pold1