Lineage for d4pkqa1 (4pkq A:266-550)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2233862Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2234004Protein automated matches [190133] (5 species)
    not a true protein
  7. 2234005Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries)
  8. 2234008Domain d4pkqa1: 4pkq A:266-550 [267182]
    Other proteins in same PDB: d4pkqa2, d4pkqa3
    automated match to d1j7na3
    complexed with edo, pge, zn

Details for d4pkqa1

PDB Entry: 4pkq (more details), 2.2 Å

PDB Description: anthrax toxin lethal factor with bound zinc
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4pkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pkqa1 d.166.1.1 (A:266-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqid
ssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiqp
ydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninn
ltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriql
spdtragylengklilqrnigleikdvqiikqsekeyiridakvv

SCOPe Domain Coordinates for d4pkqa1:

Click to download the PDB-style file with coordinates for d4pkqa1.
(The format of our PDB-style files is described here.)

Timeline for d4pkqa1: