![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein automated matches [190133] (5 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries) |
![]() | Domain d4pkqa1: 4pkq A:266-550 [267182] Other proteins in same PDB: d4pkqa2 automated match to d1j7na3 complexed with edo, pge, zn |
PDB Entry: 4pkq (more details), 2.2 Å
SCOPe Domain Sequences for d4pkqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pkqa1 d.166.1.1 (A:266-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} sryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqid ssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiqp ydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninn ltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriql spdtragylengklilqrnigleikdvqiikqsekeyiridakvv
Timeline for d4pkqa1: