SCOP 1.63: Domain d2hpeb_: 2hpe B:

Lineage for d2hpeb_ (2hpe B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d2hpeb_: 2hpe B: [26718]
   mutant

Details for d2hpeb_

PDB Entry: 2hpe, 2 Å

PDB Description: comparison of the structures of hiv-2 protease complexes in three crystal space groups with an hiv-1 protease complex structure

SCOP Domain Sequences for d2hpeb_:

Sequence; same for both SEQRES and ATOM records:

>d2hpeb_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d2hpeb_:

• d2hpeb_ first appeared (with stable ids) in SCOP 1.55
  
• d2hpeb_ appears in SCOP 1.61
  
• d2hpeb_ appears in SCOP 1.65
  
• d2hpeb_ appears in the current release, SCOPe 2.08