Lineage for d4pj6a2 (4pj6 A:367-615)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206207Species Human (Homo sapiens) [TaxId:9606] [188286] (43 PDB entries)
  8. 2206277Domain d4pj6a2: 4pj6 A:367-615 [267175]
    Other proteins in same PDB: d4pj6a1, d4pj6a3, d4pj6a4, d4pj6b1, d4pj6b3, d4pj6b4
    automated match to d4p8qa2
    complexed with lys, nag, zn

Details for d4pj6a2

PDB Entry: 4pj6 (more details), 2.96 Å

PDB Description: Crystal Structure of Human Insulin Regulated Aminopeptidase with Lysine in Active Site
PDB Compounds: (A:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj6a2 d.92.1.0 (A:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg

SCOPe Domain Coordinates for d4pj6a2:

Click to download the PDB-style file with coordinates for d4pj6a2.
(The format of our PDB-style files is described here.)

Timeline for d4pj6a2: