Lineage for d4phqd_ (4phq D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042289Superfamily h.4.4: Bacterial hemolysins [58100] (2 families) (S)
  5. 3042290Family h.4.4.1: Hemolysin E (HlyE, ClyA, SheA) [58101] (2 proteins)
  6. 3042294Protein automated matches [259924] (1 species)
    not a true protein
  7. 3042295Species Escherichia coli [TaxId:83333] [259925] (3 PDB entries)
  8. 3042299Domain d4phqd_: 4phq D: [267173]
    automated match to d4phoc_
    complexed with act, gol

Details for d4phqd_

PDB Entry: 4phq (more details), 1.94 Å

PDB Description: ClyA CC6/264 ox (6-303)
PDB Compounds: (D:) hemolysin e, chromosomal

SCOPe Domain Sequences for d4phqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4phqd_ h.4.4.1 (D:) automated matches {Escherichia coli [TaxId: 83333]}
cdktvevvknaietadgaldlynkyldqvipwqtfdetikelsrfkqeysqaasvlvgdi
ktllmdsqdkyfeatqtvyewagvatqllaayillfdeynekkasaqkdilikvlddgit
klneaqksllvssqsfnnasgkllaldsqltndfsekssyfqsqvdkirkeayagaaagv
vagpfgliisysiaagvvegklipelknklksvqnffttlsntvkqankdidaaklkltt
eiaaigeiktetettrfycdyddlmlsllkeaakkmintaneyqkrhgkk

SCOPe Domain Coordinates for d4phqd_:

Click to download the PDB-style file with coordinates for d4phqd_.
(The format of our PDB-style files is described here.)

Timeline for d4phqd_: