Lineage for d4pgpc_ (4pgp C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915487Species Desulfovibrio desulfuricans [TaxId:207559] [267990] (2 PDB entries)
  8. 2915494Domain d4pgpc_: 4pgp C: [267164]
    automated match to d4pdda_
    complexed with edo, iac

Details for d4pgpc_

PDB Entry: 4pgp (more details), 2.25 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid
PDB Compounds: (C:) Extracellular solute-binding protein, family 7

SCOPe Domain Sequences for d4pgpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pgpc_ c.94.1.0 (C:) automated matches {Desulfovibrio desulfuricans [TaxId: 207559]}
pvtlnyanfppastfpciqmeqwahevrtrtrgkvdvltypggtllgarnmlrgvmsgqa
digcislayhpgvfpvmsvfelplgftsaeaassvlwelysglrpaelervkvltmftsa
pshfmtvtpvrslrdlqgmeirgagtlsaileklgatpvsmpmpevpeavqkgiikglft
sldvmkdmnfaemtghvtradqavypfavimnreawerlspdvqqvldglaaehaawtgr
yldahvqdsmrwaeekhgvqvhtlpeediaamrrsvqplfdawaqraadkgadpdavmrt
vdalkaqygg

SCOPe Domain Coordinates for d4pgpc_:

Click to download the PDB-style file with coordinates for d4pgpc_.
(The format of our PDB-style files is described here.)

Timeline for d4pgpc_: