Lineage for d1idab_ (1ida B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins) 
Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (1 species) Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries) 
Domain d1idab_: 1ida B: [26716]
Details for d1idab_
PDB Entry: 1ida (more details), 1.7 Å
PDB Description: crystal structures of hiv-2 protease in complex with inhibitors containing the hydroxyethylamine dipeptide isostere
SCOP Domain Sequences for d1idab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1idab_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl
SCOP Domain Coordinates for d1idab_:
Click to download the PDB-style file with coordinates for d1idab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1idab_:
- d1idab_ appears in SCOP 1.57
- d1idab_ appears in the current release, SCOPe 2.08
View in 3D
