Lineage for d4pf8b_ (4pf8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2146249Species Sulfitobacter sp. [TaxId:314267] [267989] (3 PDB entries)
  8. 2146253Domain d4pf8b_: 4pf8 B: [267157]
    automated match to d4mija_
    complexed with cl, gtr

Details for d4pf8b_

PDB Entry: 4pf8 (more details), 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d- galacturonate
PDB Compounds: (B:) TRAP-T family transporter, DctP (Periplasmic binding) subunit

SCOPe Domain Sequences for d4pf8b_:

Sequence, based on SEQRES records: (download)

>d4pf8b_ c.94.1.0 (B:) automated matches {Sulfitobacter sp. [TaxId: 314267]}
kdwrgwnihvedypvshgmeafmeevtektggeikgkvfhagvlgsqpdaieqlrlgimd
fgvfslgpmgqavpatnvvslpfvfksvpqmyelmdgepgaalgkaleekgivalgyyda
garsfynsvkpintpedvqgmkvrvmnndlfvgmiesmggnatpmafaevyqsiktgvvd
gaennppsyestshfevakyysltqhliipeclcmskktfdgltpeqqeivktagknstd
lqrklwgereaasmkiimdggvevneiadksafqeamvpvyekylaanpemtdlvnlfrn
a

Sequence, based on observed residues (ATOM records): (download)

>d4pf8b_ c.94.1.0 (B:) automated matches {Sulfitobacter sp. [TaxId: 314267]}
kdwrgwnihvedypvshgmeafmeevtektggeikgkvfhagvlgsqpdaieqlrlgimd
fgvfslgpmgqavpatnvvslpfvfksvpqmyelmdgepgaalgkaleekgivalgyyda
garsfynsvkpintpedvqgmkvrvmnndlfvgmiesmggnatpmafaevyqsiktgvvd
gaennppsyestshfevakyysltqhliipeclcmskktfdgltpeqqeivktagknstd
lqrklwgereaasmkiimdggvevneidksafqeamvpvyekylaanpemtdlvnlfrna

SCOPe Domain Coordinates for d4pf8b_:

Click to download the PDB-style file with coordinates for d4pf8b_.
(The format of our PDB-style files is described here.)

Timeline for d4pf8b_: