SCOPe 2.08: Domain d4pf8a_: 4pf8 A:

Lineage for d4pf8a_ (4pf8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Sulfitobacter sp. [TaxId:314267] [267989] (3 PDB entries)

8. Domain d4pf8a_: 4pf8 A: [267156]
   automated match to d4mija_
   complexed with cl, gtr

Details for d4pf8a_

PDB Entry: 4pf8, 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d- galacturonate

PDB Compounds: (A:) TRAP-T family transporter, DctP (Periplasmic binding) subunit

SCOPe Domain Sequences for d4pf8a_:

Sequence; same for both SEQRES and ATOM records:

>d4pf8a_ c.94.1.0 (A:) automated matches {Sulfitobacter sp. [TaxId: 314267]}
dwrgwnihvedypvshgmeafmeevtektggeikgkvfhagvlgsqpdaieqlrlgimdf
gvfslgpmgqavpatnvvslpfvfksvpqmyelmdgepgaalgkaleekgivalgyydag
arsfynsvkpintpedvqgmkvrvmnndlfvgmiesmggnatpmafaevyqsiktgvvdg
aennppsyestshfevakyysltqhliipeclcmskktfdgltpeqqeivktagknstdl
qrklwgereaasmkiimdggvevneiadksafqeamvpvyekylaanpemtdlvnlfrna

Timeline for d4pf8a_:

• d4pf8a_ first appeared in SCOPe 2.05
  
• d4pf8a_ appears in SCOPe 2.07