![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Sulfitobacter sp. [TaxId:314267] [267989] (3 PDB entries) |
![]() | Domain d4pf8a_: 4pf8 A: [267156] automated match to d4mija_ complexed with cl, gtr |
PDB Entry: 4pf8 (more details), 1.5 Å
SCOPe Domain Sequences for d4pf8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pf8a_ c.94.1.0 (A:) automated matches {Sulfitobacter sp. [TaxId: 314267]} dwrgwnihvedypvshgmeafmeevtektggeikgkvfhagvlgsqpdaieqlrlgimdf gvfslgpmgqavpatnvvslpfvfksvpqmyelmdgepgaalgkaleekgivalgyydag arsfynsvkpintpedvqgmkvrvmnndlfvgmiesmggnatpmafaevyqsiktgvvdg aennppsyestshfevakyysltqhliipeclcmskktfdgltpeqqeivktagknstdl qrklwgereaasmkiimdggvevneiadksafqeamvpvyekylaanpemtdlvnlfrna
Timeline for d4pf8a_: