Lineage for d4pf6a_ (4pf6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164207Species Roseobacter denitrificans [TaxId:375451] [267986] (2 PDB entries)
  8. 2164209Domain d4pf6a_: 4pf6 A: [267155]
    automated match to d4pbqa_
    complexed with kdo, pge, so4

Details for d4pf6a_

PDB Entry: 4pf6 (more details), 1.75 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans (rd1_0742, target efi-510239) with bound 3- deoxy-d-manno-oct-2-ulosonic acid (kdo)
PDB Compounds: (A:) C4-dicarboxylate-binding protein

SCOPe Domain Sequences for d4pf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pf6a_ c.94.1.0 (A:) automated matches {Roseobacter denitrificans [TaxId: 375451]}
dkitlrmstpasetdqrsvalaevfapavagfatyqphynasliaqnseleaiasgdlem
siasaqelaqffpefsifatgyvhqsaehqvavfndplmdpfkktvedelgikllsvmyl
gqrhvnlrqtkeeltvttpadlagvnlrmpgtdawqflgkalganptpmafteiytalqt
gsvdgqdnplptvvdakfyevtnqvaltghlvdlnyiafskavwdglspeqqeivqtaad
aaaqsgrekqlakeqelvsfleeqgmeiyapdldafrthvqeqyvgsefaaswpegvldk
inalg

SCOPe Domain Coordinates for d4pf6a_:

Click to download the PDB-style file with coordinates for d4pf6a_.
(The format of our PDB-style files is described here.)

Timeline for d4pf6a_: