SCOPe 2.06: Domain d4paka1: 4pak A:33-335

Lineage for d4paka1 (4pak A:33-335)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Verminephrobacter eiseniae [TaxId:391735] [257451] (2 PDB entries)

8. Domain d4paka1: 4pak A:33-335 [267151]
   Other proteins in same PDB: d4paka2
   automated match to d4p9ka_
   complexed with paf, so4

Details for d4paka1

PDB Entry: 4pak, 1.2 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)-pantoic acid

PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4paka1:

Sequence; same for both SEQRES and ATOM records:

>d4paka1 c.94.1.0 (A:33-335) automated matches {Verminephrobacter eiseniae [TaxId: 391735]}
aaqttmrinistaqnshqgvaidtfakevekrtggrykvqtfynaalgaeresveavqlg
theltfsssgpipnfvpetkildvpflfrdkaharavldgpigqelltrfdgkgfkalaw
aengfrhmsnskravkepgdlkglkmrtmenpvhiaaykgfgivttpmafsevftalqqg
tvdgqenplsviisakfdqvqkhltltghvyspalflmnkalfdklpaadqqafidaarq
gaklnrarvdeddakgvadlrakgmtvidnidkarfvaalapvnaqfekqfgkaaleqir
saq

Timeline for d4paka1:

• d4paka1 first appeared in SCOPe 2.05, called d4paka_
  
• d4paka1 appears in SCOPe 2.07
  
• d4paka1 appears in the current release, SCOPe 2.08