Lineage for d4paka1 (4pak A:33-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916387Species Verminephrobacter eiseniae [TaxId:391735] [257451] (2 PDB entries)
  8. 2916388Domain d4paka1: 4pak A:33-335 [267151]
    Other proteins in same PDB: d4paka2
    automated match to d4p9ka_
    complexed with paf, so4

Details for d4paka1

PDB Entry: 4pak (more details), 1.2 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)-pantoic acid
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4paka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4paka1 c.94.1.0 (A:33-335) automated matches {Verminephrobacter eiseniae [TaxId: 391735]}
aaqttmrinistaqnshqgvaidtfakevekrtggrykvqtfynaalgaeresveavqlg
theltfsssgpipnfvpetkildvpflfrdkaharavldgpigqelltrfdgkgfkalaw
aengfrhmsnskravkepgdlkglkmrtmenpvhiaaykgfgivttpmafsevftalqqg
tvdgqenplsviisakfdqvqkhltltghvyspalflmnkalfdklpaadqqafidaarq
gaklnrarvdeddakgvadlrakgmtvidnidkarfvaalapvnaqfekqfgkaaleqir
saq

SCOPe Domain Coordinates for d4paka1:

Click to download the PDB-style file with coordinates for d4paka1.
(The format of our PDB-style files is described here.)

Timeline for d4paka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4paka2