![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Verminephrobacter eiseniae [TaxId:391735] [257451] (2 PDB entries) |
![]() | Domain d4paka1: 4pak A:33-335 [267151] Other proteins in same PDB: d4paka2 automated match to d4p9ka_ complexed with paf, so4 |
PDB Entry: 4pak (more details), 1.2 Å
SCOPe Domain Sequences for d4paka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4paka1 c.94.1.0 (A:33-335) automated matches {Verminephrobacter eiseniae [TaxId: 391735]} aaqttmrinistaqnshqgvaidtfakevekrtggrykvqtfynaalgaeresveavqlg theltfsssgpipnfvpetkildvpflfrdkaharavldgpigqelltrfdgkgfkalaw aengfrhmsnskravkepgdlkglkmrtmenpvhiaaykgfgivttpmafsevftalqqg tvdgqenplsviisakfdqvqkhltltghvyspalflmnkalfdklpaadqqafidaarq gaklnrarvdeddakgvadlrakgmtvidnidkarfvaalapvnaqfekqfgkaaleqir saq
Timeline for d4paka1: