Lineage for d4paia_ (4pai A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880877Species Ruegeria pomeroyi [TaxId:246200] [267988] (3 PDB entries)
  8. 1880879Domain d4paia_: 4pai A: [267150]
    automated match to d4mnpa_
    complexed with 3hb

Details for d4paia_

PDB Entry: 4pai (more details), 1.4 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from ruegeria pomeroyi dss-3 (spo1773, target efi-510260) with bound 3- hydroxybenzoate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit, putative

SCOPe Domain Sequences for d4paia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4paia_ c.94.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
kefrlglitpsphtwtkaaeafgaelseksggahsvsvfparqlgneaqmlqqlqtgald
mafmtvaevsnrvpnmgafyapylagdinhaaailrsdtargmlavlpqeagvvgvgfgs
agmrqilsrgavnsaadlsglklritpfdpildfynalgaaptpmplpavydalangqvd
aidmdvelinvlkchehadtilisnhmmfpmvglisarvyagmsdadkamiselmakhvd
stldvymvkepewtdaltkvgktfkrvdqsffgdaiaqwetiwadkapslpelrktaadl
qaenlyfq

SCOPe Domain Coordinates for d4paia_:

Click to download the PDB-style file with coordinates for d4paia_.
(The format of our PDB-style files is described here.)

Timeline for d4paia_: