Lineage for d4ozja_ (4ozj A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907708Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 1907709Protein automated matches [190753] (14 species)
    not a true protein
  7. 1907778Species Haloferax mediterranei [TaxId:523841] [258052] (3 PDB entries)
  8. 1907779Domain d4ozja_: 4ozj A: [267146]
    automated match to d4oznc_
    complexed with adp

Details for d4ozja_

PDB Entry: 4ozj (more details), 1.45 Å

PDB Description: GlnK2 from Haloferax mediterranei complexed with ADP
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4ozja_:

Sequence, based on SEQRES records: (download)

>d4ozja_ d.58.5.0 (A:) automated matches {Haloferax mediterranei [TaxId: 523841]}
lpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsqpakksqwrgeeytvd
lhqkvkvecvvadtpaedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav

Sequence, based on observed residues (ATOM records): (download)

>d4ozja_ d.58.5.0 (A:) automated matches {Haloferax mediterranei [TaxId: 523841]}
lpndggiklvmaiirpdkladvktalaevgapsltvtnvsgrgsvdlhqkvkvecvvadt
paedvadaiadaahtgekgdgkifilpvenaiqvrtgktgrdav

SCOPe Domain Coordinates for d4ozja_:

Click to download the PDB-style file with coordinates for d4ozja_.
(The format of our PDB-style files is described here.)

Timeline for d4ozja_: