Lineage for d4ovtb_ (4ovt B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915963Species Ochrobactrum anthropi [TaxId:439375] [257422] (2 PDB entries)
  8. 2915966Domain d4ovtb_: 4ovt B: [267144]
    automated match to d4n6ka_
    complexed with cl, lfc, peg

Details for d4ovtb_

PDB Entry: 4ovt (more details), 1.8 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from ochrobacterium anthropi (oant_3902), target efi-510153, with bound l- fuconate
PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4ovtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovtb_ c.94.1.0 (B:) automated matches {Ochrobactrum anthropi [TaxId: 439375]}
anvsikvayennpgepfdevmhywkddlakrsngeitlelypssqlgskkdvteqammgl
nvvtisdvgflaeydpdlgvlygpfltddpaqlfkvydgpwfkekseelkkkgihivmpn
ylygirqiiskkpirtpedlkgmkirvpnnvmqiktfeamgatptpmplgetfpalaqgv
idgvenpisvlygqkfqeeakylskvgyltnvalivggeaffstlpedqlkmihesayda
glysqkltiekdnemiekmkeagveiidvdrapfkalaekvytqfpewspglydkikael
n

SCOPe Domain Coordinates for d4ovtb_:

Click to download the PDB-style file with coordinates for d4ovtb_.
(The format of our PDB-style files is described here.)

Timeline for d4ovtb_: