SCOPe 2.07: Domain d4ovrb_: 4ovr B:

Lineage for d4ovrb_ (4ovr B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Xanthobacter autotrophicus [TaxId:78245] [267987] (1 PDB entry)

8. Domain d4ovrb_: 4ovr B: [267142]
   automated match to d4pbqa_
   complexed with cl, gtr

Details for d4ovrb_

PDB Entry: 4ovr, 1.65 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate

PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4ovrb_:

Sequence; same for both SEQRES and ATOM records:

>d4ovrb_ c.94.1.0 (B:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
qyrsadvqpadyptvkavqsmsdelnketngkisikvfpnsqlgsekdtieqvklgaldf
irinsgtlntvcpamtvpvlpflfrdkahmravldgpigdeiladcashglvglafydsg
arsfyattpirkledlkgkkirvqqsdiwvsmmkllganatpmpagevftglksglidga
ennwpsydnfhhyeaaknyslsehsmapevlliskrvfdsftpeeqvqvrkaaknsvgym
rqlwdameissrekvekagvevitidkapfqaavqplydqfvtdpklkdmitrikaaq

Timeline for d4ovrb_:

• d4ovrb_ first appeared in SCOPe 2.05
  
• d4ovrb_ appears in SCOPe 2.06
  
• d4ovrb_ appears in the current release, SCOPe 2.08