Lineage for d4ovra_ (4ovr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916443Species Xanthobacter autotrophicus [TaxId:78245] [267987] (1 PDB entry)
  8. 2916444Domain d4ovra_: 4ovr A: [267141]
    automated match to d4pbqa_
    complexed with cl, gtr

Details for d4ovra_

PDB Entry: 4ovr (more details), 1.65 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4ovra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovra_ c.94.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
rqyrsadvqpadyptvkavqsmsdelnketngkisikvfpnsqlgsekdtieqvklgald
firinsgtlntvcpamtvpvlpflfrdkahmravldgpigdeiladcashglvglafyds
garsfyattpirkledlkgkkirvqqsdiwvsmmkllganatpmpagevftglksglidg
aennwpsydnfhhyeaaknyslsehsmapevlliskrvfdsftpeeqvqvrkaaknsvgy
mrqlwdameissrekvekagvevitidkapfqaavqplydqfvtdpklkdmitrikaa

SCOPe Domain Coordinates for d4ovra_:

Click to download the PDB-style file with coordinates for d4ovra_.
(The format of our PDB-style files is described here.)

Timeline for d4ovra_: