Lineage for d4ovqa_ (4ovq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880874Species Roseobacter denitrificans [TaxId:375451] [267986] (2 PDB entries)
  8. 1880875Domain d4ovqa_: 4ovq A: [267140]
    automated match to d4mija_
    complexed with bdp, cl

Details for d4ovqa_

PDB Entry: 4ovq (more details), 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate
PDB Compounds: (A:) TRAP dicarboxylate ABC transporter, substrate-binding protein

SCOPe Domain Sequences for d4ovqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovqa_ c.94.1.0 (A:) automated matches {Roseobacter denitrificans [TaxId: 375451]}
dnwrgwnihvdgypntvamdkfaellavktggeytlqmfhggtlgsqpdaieqvragale
ignfnlgpigplvpaanvvslpfifkdvphmfrvldgeagkiiaagmaekgiqplawyda
garsfyngekpintpadvegmkvrvmnnelftgmiaelggnpspmafaevyqalktgvvd
gaennwpsyestghfevagfyslsqhliipecicinigtfnalsdemktavleaaqesal
yqrdlwnkreaasraaveaagvvvneiadkapfqaamapvyeayfeanpdlrplveliqa
te

SCOPe Domain Coordinates for d4ovqa_:

Click to download the PDB-style file with coordinates for d4ovqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ovqa_: