| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Roseobacter denitrificans [TaxId:375451] [267986] (2 PDB entries) |
| Domain d4ovqa_: 4ovq A: [267140] automated match to d4mija_ complexed with bdp, cl |
PDB Entry: 4ovq (more details), 1.5 Å
SCOPe Domain Sequences for d4ovqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ovqa_ c.94.1.0 (A:) automated matches {Roseobacter denitrificans [TaxId: 375451]}
dnwrgwnihvdgypntvamdkfaellavktggeytlqmfhggtlgsqpdaieqvragale
ignfnlgpigplvpaanvvslpfifkdvphmfrvldgeagkiiaagmaekgiqplawyda
garsfyngekpintpadvegmkvrvmnnelftgmiaelggnpspmafaevyqalktgvvd
gaennwpsyestghfevagfyslsqhliipecicinigtfnalsdemktavleaaqesal
yqrdlwnkreaasraaveaagvvvneiadkapfqaamapvyeayfeanpdlrplveliqa
te
Timeline for d4ovqa_: