Lineage for d4otob1 (4oto B:232-720)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016947Fold a.298: Left-handed alpha-alpha superhelix [267589] (1 superfamily)
    multihelical; 2 (curved) layers: alpha/alpha; left-handed superhelix
  4. 2016948Superfamily a.298.1: TAL effector-like [267596] (1 family) (S)
    Pfam PF03377; repeat; repeats form left-handed bundles that associate in a right-handed superstructure. PubMed 22223736
  5. 2016949Family a.298.1.1: TAL (transcription activator-like) effector [267609] (5 protein domains)
  6. 2016965Protein automated matches [267685] (1 species)
    not a true protein
  7. 2016966Species Xanthomonas campestris [TaxId:329463] [267985] (16 PDB entries)
  8. 2016992Domain d4otob1: 4oto B:232-720 [267138]
    Other proteins in same PDB: d4otoa2, d4otob2
    automated match to d3v6ta_
    protein/DNA complex; mutant

Details for d4otob1

PDB Entry: 4oto (more details), 2.59 Å

PDB Description: Crystal structure of the S505W mutant of TAL effector dHax3
PDB Compounds: (B:) Hax3

SCOPe Domain Sequences for d4otob1:

Sequence, based on SEQRES records: (download)

>d4otob1 a.298.1.1 (B:232-720) automated matches {Xanthomonas campestris [TaxId: 329463]}
wsgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnltp
eqvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvl
cqahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqalet
vqrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiasng
ggkqaletvqrllpvlcqahgltpqqvvaiasnwggkqaletvqrllpvlcqahgltpqq
vvaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcq
ahgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqaletvq
rllpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalaclgg
rpaldavkk

Sequence, based on observed residues (ATOM records): (download)

>d4otob1 a.298.1.1 (B:232-720) automated matches {Xanthomonas campestris [TaxId: 329463]}
wsgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnltp
eqvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvl
cqahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqalet
vqrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiasng
ggkqaletvqrllpvlcqahgltpqqvvaiasnwggkqaletvqrllpvlcqahgltpqq
vvaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcq
ahgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqaletvq
rllpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdaltndhlvalaclggrpal
davkk

SCOPe Domain Coordinates for d4otob1:

Click to download the PDB-style file with coordinates for d4otob1.
(The format of our PDB-style files is described here.)

Timeline for d4otob1:

  • d4otob1 first appeared in SCOPe 2.05, called d4otob_

View in 3D
Domains from same chain:
(mouse over for more information)
d4otob2