Lineage for d4otla_ (4otl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132006Species Burkholderia cenocepacia [TaxId:216591] [229698] (4 PDB entries)
  8. 2132017Domain d4otla_: 4otl A: [267133]
    Other proteins in same PDB: d4otld2
    automated match to d4n0wa_
    complexed with edo, gly, plp

Details for d4otla_

PDB Entry: 4otl (more details), 2 Å

PDB Description: X-ray Crystal Structure of Serine Hydroxymethyl Transferase from Burkholderia cenocepacia bound to PLP and Glycine
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4otla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4otla_ c.67.1.4 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
stianvdpeifaaieqenrrqedhieliasenytspavmaaqgsqltnkyaegypgkryy
ggceyvdvveqlaidrvkqlfgaeaanvqpnsgsqanqgvffamlkpgdtimgmslahgg
hlthgspvnmsgkwfnvvsyglnenedidydaaeklanehkpklivagasafalkidfer
lakiaksvgaylmvdmahyagliaagvypnpvphadfvtttthkslrgprggvilmkaey
ekpinsaifpgiqggplmhviaakavafkealspefkeyqqkvvenarvlaetlvkrglr
ivsgrteshvmlvdlrakhitgkaaeaalgaahitvnknaipndpekpfvtsgirlgspa
mttrgfgpaeaeqvgnliadvlenpedaatiervraqvaeltkrfpvyr

SCOPe Domain Coordinates for d4otla_:

Click to download the PDB-style file with coordinates for d4otla_.
(The format of our PDB-style files is described here.)

Timeline for d4otla_: