Lineage for d4osia_ (4osi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016947Fold a.298: Left-handed alpha-alpha superhelix [267589] (1 superfamily)
    multihelical; 2 (curved) layers: alpha/alpha; left-handed superhelix
  4. 2016948Superfamily a.298.1: TAL effector-like [267596] (1 family) (S)
    Pfam PF03377; repeat; repeats form left-handed bundles that associate in a right-handed superstructure. PubMed 22223736
  5. 2016949Family a.298.1.1: TAL (transcription activator-like) effector [267609] (5 protein domains)
  6. 2016965Protein automated matches [267685] (1 species)
    not a true protein
  7. 2016966Species Xanthomonas campestris [TaxId:329463] [267985] (16 PDB entries)
  8. 2016997Domain d4osia_: 4osi A: [267101]
    Other proteins in same PDB: d4osib2
    automated match to d3v6ta_
    protein/DNA complex

Details for d4osia_

PDB Entry: 4osi (more details), 2.85 Å

PDB Description: Crystal structure of the TAL effector dHax3 with NI RVD at 2.8 angstrom resolution
PDB Compounds: (A:) Hax3

SCOPe Domain Sequences for d4osia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4osia_ a.298.1.1 (A:) automated matches {Xanthomonas campestris [TaxId: 329463]}
ralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnltpeqvv
aiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcqah
gltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqaletvqrl
lpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiasngggkq
aletvqrllpvlcqahgltpqqvvaiasniggkqaletvqrllpvlcqahgltpqqvvai
asngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcqahgl
tpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqaletvqrllp
vlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalaclggrpal
davkk

SCOPe Domain Coordinates for d4osia_:

Click to download the PDB-style file with coordinates for d4osia_.
(The format of our PDB-style files is described here.)

Timeline for d4osia_: