Lineage for d4oshb_ (4osh B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1755393Fold a.298: Left-handed alpha-alpha superhelix [267589] (1 superfamily)
    multihelical; 2 (curved) layers: alpha/alpha; left-handed superhelix
  4. 1755394Superfamily a.298.1: TAL effector-like [267596] (1 family) (S)
    Pfam PF03377; repeat; repeats form left-handed bundles that associate in a right-handed superstructure. PubMed 22223736
  5. 1755395Family a.298.1.1: TAL (transcription activator-like) effector [267609] (5 protein domains)
  6. 1755411Protein automated matches [267685] (1 species)
    not a true protein
  7. 1755412Species Xanthomonas campestris [TaxId:329463] [267985] (16 PDB entries)
  8. 1755422Domain d4oshb_: 4osh B: [267100]
    automated match to d3v6ta_
    protein/DNA complex

Details for d4oshb_

PDB Entry: 4osh (more details), 2.2 Å

PDB Description: Crystal structure of the TAL effector dHax3 with NI RVD at 2.2 angstrom resolution
PDB Compounds: (B:) Hax3

SCOPe Domain Sequences for d4oshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oshb_ a.298.1.1 (B:) automated matches {Xanthomonas campestris [TaxId: 329463]}
sgaralealltvagelrgpplqldtgqllkiakrggvtaveavhawrnaltgaplnltpe
qvvaiashdggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlc
qahgltpeqvvaiashdggkqaletvqallpvlcqahgltpeqvvaiasngggkqaletv
qrllpvlcqahgltpqqvvaiasngggkqaletvqrllpvlcqahgltpqqvvaiasngg
gkqaletvqrllpvlcqahgltpqqvvaiasniggkqaletvqrllpvlcqahgltpqqv
vaiasngggkqaletvqrllpvlcqahgltpqqvvaiashdggkqaletvqrllpvlcqa
hgltpeqvvaiasngggkqaletvqrllpvlcqahgltpeqvvaiashdggkqaletvqr
llpvlcqahgltpqqvvaiasngggrpalesivaqlsrpdpalaaltndhlvalaclggr
paldavkkl

SCOPe Domain Coordinates for d4oshb_:

Click to download the PDB-style file with coordinates for d4oshb_.
(The format of our PDB-style files is described here.)

Timeline for d4oshb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4osha_