Lineage for d4orma_ (4orm A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091728Protein automated matches [190228] (18 species)
    not a true protein
  7. 2091790Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256645] (7 PDB entries)
  8. 2091793Domain d4orma_: 4orm A: [267094]
    automated match to d4cq8a_
    complexed with 2v6, fmn, gol, oro, so4

Details for d4orma_

PDB Entry: 4orm (more details), 2.07 Å

PDB Description: crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm338 (n-[3,5-difluoro-4- (trifluoromethyl)phenyl]-5-methyl-2-(trifluoromethyl)[1,2, 4]triazolo[1,5-a]pyrimidin-7-amine)
PDB Compounds: (A:) Dihydroorotate dehydrogenase (quinone), mitochondrial

SCOPe Domain Sequences for d4orma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4orma_ c.1.4.1 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldfinp
fgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscgfnn
mgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryadyia
invsspntpglrdnqeagklkniilsvkeeidnleknnimndeflwfnttkkkplvfvkl
apdlnqeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkfic
emynytnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhll
yqrgyynlkeaigrk

SCOPe Domain Coordinates for d4orma_:

Click to download the PDB-style file with coordinates for d4orma_.
(The format of our PDB-style files is described here.)

Timeline for d4orma_: