Lineage for d4orgd2 (4org D:108-209)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030565Domain d4orgd2: 4org D:108-209 [267089]
    Other proteins in same PDB: d4orgb1, d4orgd1, d4orgf1, d4orgl1
    automated match to d3zl4l2

Details for d4orgd2

PDB Entry: 4org (more details), 3.12 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.04, a potent V1V2-directed HIV-1 neutralizing antibody
PDB Compounds: (D:) CAP256-VRC26.04 light chain

SCOPe Domain Sequences for d4orgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4orgd2 b.1.1.2 (D:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4orgd2:

Click to download the PDB-style file with coordinates for d4orgd2.
(The format of our PDB-style files is described here.)

Timeline for d4orgd2: