Lineage for d4oo0b_ (4oo0 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2136092Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2136154Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2136155Protein automated matches [190179] (8 species)
    not a true protein
  7. 2136156Species Burkholderia cenocepacia [TaxId:216591] [267984] (1 PDB entry)
  8. 2136158Domain d4oo0b_: 4oo0 B: [267085]
    automated match to d4p0ub_
    complexed with edo, po4

Details for d4oo0b_

PDB Entry: 4oo0 (more details), 2.15 Å

PDB Description: crystal structure of maf-like protein bcej2315_23540 from burkholderia cenocepacia
PDB Compounds: (B:) Maf-like protein BCAL2394

SCOPe Domain Sequences for d4oo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oo0b_ c.51.4.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tplfqtlylasqsprrqellqqigvrfelllprpdedaealeaelpgeaadayvrrvtva
kaeaararlvasgkpaapvlvadttvtidgailgkptdaddalamltrlagrehavltav
avidasgellppalsrssvrfaaasrdayvryvetgepfgkagayaiqgraaefieridg
shsgimglplfetaallrtarvaf

SCOPe Domain Coordinates for d4oo0b_:

Click to download the PDB-style file with coordinates for d4oo0b_.
(The format of our PDB-style files is described here.)

Timeline for d4oo0b_: