Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (8 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [267984] (1 PDB entry) |
Domain d4oo0b_: 4oo0 B: [267085] automated match to d4p0ub_ complexed with edo, po4 |
PDB Entry: 4oo0 (more details), 2.15 Å
SCOPe Domain Sequences for d4oo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oo0b_ c.51.4.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} tplfqtlylasqsprrqellqqigvrfelllprpdedaealeaelpgeaadayvrrvtva kaeaararlvasgkpaapvlvadttvtidgailgkptdaddalamltrlagrehavltav avidasgellppalsrssvrfaaasrdayvryvetgepfgkagayaiqgraaefieridg shsgimglplfetaallrtarvaf
Timeline for d4oo0b_: