Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (14 PDB entries) |
Domain d4omde2: 4omd E:443-574 [267081] Other proteins in same PDB: d4omda1, d4omdb1, d4omdc1, d4omdd1, d4omde1, d4omdf1 automated match to d1p8ja1 complexed with ca, fmt, na |
PDB Entry: 4omd (more details), 2.7 Å
SCOPe Domain Sequences for d4omde2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4omde2 b.18.1.0 (E:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt ltkftlvlygta
Timeline for d4omde2: