Lineage for d4omde2 (4omd E:443-574)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775303Domain d4omde2: 4omd E:443-574 [267081]
    Other proteins in same PDB: d4omda1, d4omdb1, d4omdc1, d4omdd1, d4omde1, d4omdf1
    automated match to d1p8ja1
    complexed with ca, fmt, na

Details for d4omde2

PDB Entry: 4omd (more details), 2.7 Å

PDB Description: X-ray structure of human furin in complex with the competitive inhibitor Phac-RVR-Amba
PDB Compounds: (E:) Furin

SCOPe Domain Sequences for d4omde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omde2 b.18.1.0 (E:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla
ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt
ltkftlvlygta

SCOPe Domain Coordinates for d4omde2:

Click to download the PDB-style file with coordinates for d4omde2.
(The format of our PDB-style files is described here.)

Timeline for d4omde2: