Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (17 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (13 PDB entries) |
Domain d4ojnf1: 4ojn F:2-160 [267064] Other proteins in same PDB: d4ojna2, d4ojnb2, d4ojnc2, d4ojnd2, d4ojne2, d4ojnf2, d4ojng2, d4ojnh2 automated match to d4l4ra1 complexed with 1pe, gol |
PDB Entry: 4ojn (more details), 2.4 Å
SCOPe Domain Sequences for d4ojnf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ojnf1 c.2.1.5 (F:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d4ojnf1: