SCOPe 2.05: Domain d4ojnc1: 4ojn C:2-160

Lineage for d4ojnc1 (4ojn C:2-160)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (17 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (13 PDB entries)

8. Domain d4ojnc1: 4ojn C:2-160 [267058]
   Other proteins in same PDB: d4ojna2, d4ojnb2, d4ojnc2, d4ojnd2, d4ojne2, d4ojnf2, d4ojng2, d4ojnh2
   automated match to d4l4ra1
   complexed with 1pe, gol

Details for d4ojnc1

PDB Entry: 4ojn, 2.4 Å

PDB Description: Crystal structure of human muscle L-lactate dehydrogenase

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4ojnc1:

Sequence; same for both SEQRES and ATOM records:

>d4ojnc1 c.2.1.5 (C:2-160) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d4ojnc1:

• d4ojnc1 is new in SCOPe 2.05-stable
  
• d4ojnc1 appears in SCOPe 2.06
  
• d4ojnc1 appears in the current release, SCOPe 2.08