Lineage for d4oiim2 (4oii M:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. 2753280Domain d4oiim2: 4oii M:108-213 [267053]
    Other proteins in same PDB: d4oiih1, d4oiih2, d4oiii1, d4oiii2, d4oiil1, d4oiim1
    automated match to d3ojda2

Details for d4oiim2

PDB Entry: 4oii (more details), 3 Å

PDB Description: west nile virus ns1 in complex with neutralizing 22ns1 antibody fab
PDB Compounds: (M:) Light Chain of Fab fragment of 22NS1 Antibody

SCOPe Domain Sequences for d4oiim2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oiim2 b.1.1.2 (M:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4oiim2:

Click to download the PDB-style file with coordinates for d4oiim2.
(The format of our PDB-style files is described here.)

Timeline for d4oiim2: