SCOPe 2.08: Domain d4oiil1: 4oii L:1-107

Lineage for d4oiil1 (4oii L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4oiil1: 4oii L:1-107 [267050]
   Other proteins in same PDB: d4oiih1, d4oiih2, d4oiii1, d4oiii2, d4oiil2, d4oiim2
   automated match to d3ojda1

Details for d4oiil1

PDB Entry: 4oii, 3 Å

PDB Description: west nile virus ns1 in complex with neutralizing 22ns1 antibody fab

PDB Compounds: (L:) Light Chain of Fab fragment of 22NS1 Antibody

SCOPe Domain Sequences for d4oiil1:

Sequence; same for both SEQRES and ATOM records:

>d4oiil1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
rfsasgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleik

Timeline for d4oiil1:

• d4oiil1 first appeared in SCOPe 2.05
  
• d4oiil1 appears in SCOPe 2.07