Lineage for d4ofnb2 (4ofn B:78-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714092Species Necator americanus [TaxId:51031] [224849] (6 PDB entries)
  8. 2714113Domain d4ofnb2: 4ofn B:78-206 [267049]
    Other proteins in same PDB: d4ofna1, d4ofnb1
    automated match to d2on7a2
    complexed with gsh

Details for d4ofnb2

PDB Entry: 4ofn (more details), 2.69 Å

PDB Description: monoclinic nagst1
PDB Compounds: (B:) Glutathione S-transferase-1

SCOPe Domain Sequences for d4ofnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ofnb2 a.45.1.0 (B:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit
kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw
ietrpetlf

SCOPe Domain Coordinates for d4ofnb2:

Click to download the PDB-style file with coordinates for d4ofnb2.
(The format of our PDB-style files is described here.)

Timeline for d4ofnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ofnb1