SCOPe 2.06: Domain d4ofmb2: 4ofm B:78-206

Lineage for d4ofmb2 (4ofm B:78-206)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Necator americanus [TaxId:51031] [224849] (6 PDB entries)

8. Domain d4ofmb2: 4ofm B:78-206 [267041]
   Other proteins in same PDB: d4ofma1, d4ofmb1, d4ofmc1, d4ofmd1
   automated match to d2on7a2
   complexed with gsh

Details for d4ofmb2

PDB Entry: 4ofm, 2.64 Å

PDB Description: triclinic nagst1

PDB Compounds: (B:) Glutathione S-transferase-1

SCOPe Domain Sequences for d4ofmb2:

Sequence; same for both SEQRES and ATOM records:

>d4ofmb2 a.45.1.0 (B:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit
kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw
ietrpetlf

Timeline for d4ofmb2:

• d4ofmb2 first appeared in SCOPe 2.05
  
• d4ofmb2 appears in SCOPe 2.07
  
• d4ofmb2 appears in the current release, SCOPe 2.08