| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Necator americanus [TaxId:51031] [224893] (6 PDB entries) |
| Domain d4ofmb1: 4ofm B:1-77 [267040] Other proteins in same PDB: d4ofma2, d4ofmb2, d4ofmc2, d4ofmd2 automated match to d2on7a1 complexed with gsh |
PDB Entry: 4ofm (more details), 2.64 Å
SCOPe Domain Sequences for d4ofmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ofmb1 c.47.1.0 (B:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
laqslaicrylarqfgf
Timeline for d4ofmb1: