Lineage for d4oesa_ (4oes A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162796Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2162797Species Brucella suis [TaxId:29461] [259856] (2 PDB entries)
  8. 2162800Domain d4oesa_: 4oes A: [267035]
    automated match to d4oera_
    complexed with edt, fe, gol, so4

Details for d4oesa_

PDB Entry: 4oes (more details), 1.95 Å

PDB Description: Crystal structure of NikA from Brucella suis in complex with Fe(III)-EDTA
PDB Compounds: (A:) NikA protein

SCOPe Domain Sequences for d4oesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oesa_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Brucella suis [TaxId: 29461]}
dpklnfswpvnvgplnphlyspnqmfaqnmvyeplvhynadgtvgpwlaesweasqdgrs
ytfklredvkfsngevfdaaavkanidtvlqnrprhnwlelvnqmvsaevvgpykvrinl
kkpyypllqelslprpfrfiapsqfknggtadgivapigtgpwkltetklgehdvftrnd
sywgpkpayeqitvkvipdpntraiafeageidliygtegpispdtferfqkmgiyntel
sepletrvlalntnhgatkdlavrkainhavdkdtmiatvlygtqkradtlfadnvpyan
iglkpyafdpalaarlldeagwtakasgdirekdgqplaielcfigtdaisksmaeivqa
dlrkvgidvkltgeeessiyarqrdgrfdmifnqtwgapydphafvssmrvpshadyqaq
lglpdkakidaeigqvlvstdetarqalykdiltrlheeavylpltsvtamavakpevgk
itfgamsseipfekltpk

SCOPe Domain Coordinates for d4oesa_:

Click to download the PDB-style file with coordinates for d4oesa_.
(The format of our PDB-style files is described here.)

Timeline for d4oesa_: