Lineage for d4od7c1 (4od7 C:2-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878773Protein automated matches [190208] (8 species)
    not a true protein
  7. 2878800Species Proteus mirabilis [TaxId:529507] [257245] (3 PDB entries)
  8. 2878803Domain d4od7c1: 4od7 C:2-187 [267032]
    Other proteins in same PDB: d4od7a2, d4od7b2, d4od7c2
    automated match to d4mcue_
    complexed with scn

Details for d4od7c1

PDB Entry: 4od7 (more details), 1.6 Å

PDB Description: complex structure of proteus mirablis dsba (c30s) with a non- covalently bound peptide pwatcds
PDB Compounds: (C:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4od7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4od7c1 c.47.1.13 (C:2-187) automated matches {Proteus mirabilis [TaxId: 529507]}
disegkqytnlskpvagapqvveffsfysphcyqfsevykvnstveknvpentkmaryhv
dflgplgkemtrawavaialgvedqvspalfkgiqetqsirsvddirttfinagvkaedy
daainsfvvnslvsqqqnavtdfqingvpamvidgkykmkndgisakspeeyakaysdvv
nqllmk

SCOPe Domain Coordinates for d4od7c1:

Click to download the PDB-style file with coordinates for d4od7c1.
(The format of our PDB-style files is described here.)

Timeline for d4od7c1: