SCOPe 2.07: Domain d4oana1: 4oan A:30-339

Lineage for d4oana1 (4oan A:30-339)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:316058] [267982] (2 PDB entries)

8. Domain d4oana1: 4oan A:30-339 [267020]
   Other proteins in same PDB: d4oana2
   automated match to d4pdda_
   complexed with cl, gol, x2x

Details for d4oana1

PDB Entry: 4oan, 1.35 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate)

PDB Compounds: (A:) TRAP dicarboxylate transporter DctP subunit

SCOPe Domain Sequences for d4oana1:

Sequence; same for both SEQRES and ATOM records:

>d4oana1 c.94.1.0 (A:30-339) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
aeaefvykyannlpdthpmniraremaaaikaetngrvqidifpsnqlgsdtdmlsqirs
ggvefftlsglilstlvpaasingigfafpdydtvwkamdgelggyvrgeigkaglvvmd
kiwdngfrqtttstrpitgpddfkglkirvpvsplwtsmfkafdaspasinfsevysalq
tkvvegqenplaiistaklyevqkycsltnhmwdgfwflanrrawerlpadlrdivarni
naagvnqradvaklnaglkdelatkgltfnqptigpfrdklraagfyaewkgkygeqaws
lleksvgkla

Timeline for d4oana1:

• d4oana1 first appeared in SCOPe 2.05, called d4oana_
  
• d4oana1 appears in SCOPe 2.06
  
• d4oana1 appears in the current release, SCOPe 2.08