Lineage for d4o94a_ (4o94 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880867Species Rhodopseudomonas palustris [TaxId:316058] [267982] (2 PDB entries)
  8. 1880870Domain d4o94a_: 4o94 A: [267012]
    automated match to d4pdda_
    complexed with cl, sin

Details for d4o94a_

PDB Entry: 4o94 (more details), 2 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from Rhodopseudomonas palustris HaA2 (RPB_3329), Target EFI-510223, with bound succinate
PDB Compounds: (A:) TRAP dicarboxylate transporter DctP subunit

SCOPe Domain Sequences for d4o94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o94a_ c.94.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
qpivvkfshvvadntpkgqaaikfkelaekytngkvkvevypnsqlfgdakemeavalgd
vqfiapslskfdkftkqiqvfdlpflfndiaavdrfqagkqgqallrsmesknflglayw
hngmkqisanrpllkpedakglkfriqasdilaaqfqglnatpqklafsevyqalqvgtv
dgqentwsnifsqkfyevqkditesdhgvidymvvvnakwwnglskdlqdamkkamdeat
kvnndvagklndeakqkiassgaskihqltpeqrkqwveamkpvwakfesaigkdlidaa
vasndtktn

SCOPe Domain Coordinates for d4o94a_:

Click to download the PDB-style file with coordinates for d4o94a_.
(The format of our PDB-style files is described here.)

Timeline for d4o94a_: