Lineage for d4o8ya1 (4o8y A:2-178)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2148136Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2148174Family c.97.3.0: automated matches [267623] (1 protein)
    not a true family
  6. 2148175Protein automated matches [267670] (3 species)
    not a true protein
  7. 2148178Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries)
  8. 2148180Domain d4o8ya1: 4o8y A:2-178 [267011]
    Other proteins in same PDB: d4o8ya2
    automated match to d2o95a_
    complexed with edo

Details for d4o8ya1

PDB Entry: 4o8y (more details), 1.95 Å

PDB Description: zinc-free rpn11 in complex with rpn8
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4o8ya1:

Sequence, based on SEQRES records: (download)

>d4o8ya1 c.97.3.0 (A:2-178) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdv

Sequence, based on observed residues (ATOM records): (download)

>d4o8ya1 c.97.3.0 (A:2-178) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqvtektflhlpctieaeeaeeigvehllrdv

SCOPe Domain Coordinates for d4o8ya1:

Click to download the PDB-style file with coordinates for d4o8ya1.
(The format of our PDB-style files is described here.)

Timeline for d4o8ya1:

  • d4o8ya1 first appeared in SCOPe 2.05, called d4o8ya_