SCOPe 2.08: Domain d4o8ya1: 4o8y A:2-178

Lineage for d4o8ya1 (4o8y A:2-178)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
   Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)

6. Protein Proteasome regulatory subunit Rpn8 [346089] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries)

8. Domain d4o8ya1: 4o8y A:2-178 [267011]
   Other proteins in same PDB: d4o8ya2, d4o8yb_
   automated match to d2o95a_
   complexed with edo

Details for d4o8ya1

PDB Entry: 4o8y, 1.95 Å

PDB Description: zinc-free rpn11 in complex with rpn8

PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4o8ya1:

Sequence, based on SEQRES records:

>d4o8ya1 c.97.3.1 (A:2-178) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdv

Sequence, based on observed residues (ATOM records):

>d4o8ya1 c.97.3.1 (A:2-178) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqvtektflhlpctieaeeaeeigvehllrdv

Timeline for d4o8ya1:

• d4o8ya1 first appeared in SCOPe 2.05, called d4o8ya_
  
• d4o8ya1 appears in SCOPe 2.07