Lineage for d4o8xa1 (4o8x A:2-178)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489936Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2490288Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2490289Family c.97.3.1: JAB1/MPN domain [102713] (8 protein domains)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2490321Protein Proteasome regulatory subunit Rpn8 [346089] (1 species)
  7. 2490322Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries)
  8. 2490325Domain d4o8xa1: 4o8x A:2-178 [267010]
    Other proteins in same PDB: d4o8xa2, d4o8xb_
    automated match to d2o95a_
    complexed with edo, zn

Details for d4o8xa1

PDB Entry: 4o8x (more details), 1.99 Å

PDB Description: zinc-bound rpn11 in complex with rpn8
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4o8xa1:

Sequence, based on SEQRES records: (download)

>d4o8xa1 c.97.3.1 (A:2-178) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdv

Sequence, based on observed residues (ATOM records): (download)

>d4o8xa1 c.97.3.1 (A:2-178) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqtektflhlpctieaeeaeeigvehllrdv

SCOPe Domain Coordinates for d4o8xa1:

Click to download the PDB-style file with coordinates for d4o8xa1.
(The format of our PDB-style files is described here.)

Timeline for d4o8xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o8xa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4o8xb_