Lineage for d4o8md_ (4o8m D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163421Species Actinobacillus succinogenes [TaxId:339671] [267981] (1 PDB entry)
  8. 2163425Domain d4o8md_: 4o8m D: [267005]
    automated match to d4p47a_
    complexed with 2q2, cl, so4

Details for d4o8md_

PDB Entry: 4o8m (more details), 1.7 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein actinobacillus succinogenes 130z, target EFI-510004, with bound L-galactonate
PDB Compounds: (D:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4o8md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o8md_ c.94.1.0 (D:) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
eteimvaygnqpgepidkamhfwadkvkeksngdivfklfpssqlgsetevleqakfgan
iitisdygalmdivpdlgvinapyisqsfekkskllhsdwfkdlsdkldqhdihiivpdv
iygtrhlltkkpvtkpsdlkgmkvrvqhsrlflqtinamggvptpmslsdvypglsegii
dglenptvvlfggkffevaknlnltahtkhmspfvagtafwnnltpeqqkiivdasremv
tyggglieqaenealenlkkagvtvndvdlpafeasvadvistgfpewspnlyknvqekl
s

SCOPe Domain Coordinates for d4o8md_:

Click to download the PDB-style file with coordinates for d4o8md_.
(The format of our PDB-style files is described here.)

Timeline for d4o8md_: