Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (120 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [267981] (1 PDB entry) |
Domain d4o8mb_: 4o8m B: [267003] automated match to d4p47a_ complexed with 2q2, cl, so4 |
PDB Entry: 4o8m (more details), 1.7 Å
SCOPe Domain Sequences for d4o8mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o8mb_ c.94.1.0 (B:) automated matches {Actinobacillus succinogenes [TaxId: 339671]} eteimvaygnqpgepidkamhfwadkvkeksngdivfklfpssqlgsetevleqakfgan iitisdygalmdivpdlgvinapyisqsfekkskllhsdwfkdlsdkldqhdihiivpdv iygtrhlltkkpvtkpsdlkgmkvrvqhsrlflqtinamggvptpmslsdvypglsegii dglenptvvlfggkffevaknlnltahtkhmspfvagtafwnnltpeqqkiivdasremv tyggglieqaenealenlkkagvtvndvdlpafeasvadvistgfpewspnlyknvqekl sqf
Timeline for d4o8mb_: