SCOPe 2.07: Domain d4o7mc_: 4o7m C:

Lineage for d4o7mc_ (4o7m C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Shewanella loihica [TaxId:323850] [267980] (2 PDB entries)

8. Domain d4o7mc_: 4o7m C: [267000]
   automated match to d4ovsa_
   complexed with lmr, so4

Details for d4o7mc_

PDB Entry: 4o7m, 1.5 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from shewanella loihica PV-4, target EFI-510273, with bound L-malate

PDB Compounds: (C:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4o7mc_:

Sequence; same for both SEQRES and ATOM records:

>d4o7mc_ c.94.1.0 (C:) automated matches {Shewanella loihica [TaxId: 323850]}
apteikfshvvaentpkgqmalkfkqlveerlpgeyqvnvfpnsqlfgdnnelsalllnd
vqfvapslskferytkklqlfdlpflfkdmdavnrfqqsdagqqllnsmkrkgvvglgyl
hngmkqfsassplvlpedaqgkkfrimasdvlaaqfqaveaipvkkpfsevftllqtrai
dgqentwsniyskkfyevqsnitesnhgvldymvvtsntfwkslpadkrkvikasldeai
aygneiaaakvnkdkqaiidskrsevtyltpeqraawvnamkp

Timeline for d4o7mc_:

• d4o7mc_ first appeared in SCOPe 2.05
  
• d4o7mc_ appears in SCOPe 2.06
  
• d4o7mc_ appears in the current release, SCOPe 2.08