Lineage for d4o7ma_ (4o7m A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916119Species Shewanella loihica [TaxId:323850] [267980] (2 PDB entries)
  8. 2916120Domain d4o7ma_: 4o7m A: [266998]
    automated match to d4ovsa_
    complexed with lmr, so4

Details for d4o7ma_

PDB Entry: 4o7m (more details), 1.5 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from shewanella loihica PV-4, target EFI-510273, with bound L-malate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4o7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o7ma_ c.94.1.0 (A:) automated matches {Shewanella loihica [TaxId: 323850]}
pteikfshvvaentpkgqmalkfkqlveerlpgeyqvnvfpnsqlfgdnnelsalllndv
qfvapslskferytkklqlfdlpflfkdmdavnrfqqsdagqqllnsmkrkgvvglgylh
ngmkqfsassplvlpedaqgkkfrimasdvlaaqfqaveaipvkkpfsevftllqtraid
gqentwsniyskkfyevqsnitesnhgvldymvvtsntfwkslpadkrkvikasldeaia
ygneiaaakvnkdkqaiidskrsevtyltpeqraawvnamkpvwaqfedkigkdlidaav
asne

SCOPe Domain Coordinates for d4o7ma_:

Click to download the PDB-style file with coordinates for d4o7ma_.
(The format of our PDB-style files is described here.)

Timeline for d4o7ma_: