SCOPe 2.08: Domain d4nxba1: 4nxb A:389-496

Lineage for d4nxba1 (4nxb A:389-496)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
   contains PAC motif

6. Protein automated matches [190943] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries)

8. Domain d4nxba1: 4nxb A:389-496 [266989]
   Other proteins in same PDB: d4nxba2
   automated match to d4eesa_
   complexed with fmn

Details for d4nxba1

PDB Entry: 4nxb, 2.56 Å

PDB Description: crystal structure of ilov-i486(2lt) at ph 7.0

PDB Compounds: (A:) Phototropin-2

SCOPe Domain Sequences for d4nxba1:

Sequence; same for both SEQRES and ATOM records:

>d4nxba1 d.110.3.6 (A:389-496) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knfvitdprlpdnpiifasdgflelteysreeilgrnarflqgpetdqatvqkirdaird
qrettvqlinytksgkkfwnllhlqpvrdqkgelqyfxgvqldgsdhv

Timeline for d4nxba1:

• d4nxba1 first appeared in SCOPe 2.05, called d4nxba_
  
• d4nxba1 appears in SCOPe 2.07